| Edit |   |
|---|
| Antigenic Specificity | Apolipoprotein L4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Apolipoprotein L4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Apolipoprotein L4. This antibody reacts with human. The Apolipoprotein L4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Apolipoprotein L4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TSTDQLEALRDILRDITPNVLSFALDFDEATKMIANDVHTLRRSKATVGR PLIAWRYVPINVVETLRTRGAPTRIVRKVARNL |
|---|
| Other Names | apolipoprotein L, 4, apolipoprotein L4, Apolipoprotein L-IV, APOLIV, APOL-IV |
|---|
| Gene, Accession # | APOL4, Gene ID: 80832, Accession: Q9BPW4, SwissProt: Q9BPW4 |
|---|
| Catalog # | NBP2-14302 |
|---|
| Price | |
|---|
| Order / More Info | Apolipoprotein L4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|