| Edit |   |
|---|
| Antigenic Specificity | Jagged 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Jagged 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Jagged 2. This antibody reacts with human. The Jagged 2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to JAG2(jagged 2) The peptide sequence was selected from the N terminal of JAG2. Peptide sequence RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD. |
|---|
| Other Names | HJ2, jagged 2, Jagged2, protein jagged-2, SER2 |
|---|
| Gene, Accession # | JAG2, Gene ID: 3714, Accession: Q9Y219, SwissProt: Q9Y219 |
|---|
| Catalog # | NBP1-58284-20ul |
|---|
| Price | |
|---|
| Order / More Info | Jagged 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|