| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Jagged 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 27183608). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Jagged 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Jagged 2. This antibody reacts with human, mouse. The Jagged 2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity of human, mouse Jagged 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS |
|---|
| Other Names | HJ2, jagged 2, Jagged2, protein jagged-2, SER2 |
|---|
| Gene, Accession # | JAG2, Gene ID: 3714 |
|---|
| Catalog # | NBP1-86337 |
|---|
| Price | |
|---|
| Order / More Info | Jagged 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27183608 |
|---|
| 产品资料 |
|
|