| Edit |   |
| Antigenic Specificity | APH1B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The APH1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to APH1B. This antibody reacts with human, mouse. The APH1B Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Gamma-secretase subunit APH-1B - C-terminal region. Peptide sequence YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR. |
| Other Names | anterior pharynx defective 1 homolog B (C. elegans) |
| Gene, Accession # | APH1B, Gene ID: 83464, Accession: NP_001139118, SwissProt: NP_001139118 |
| Catalog # | NBP1-98414-20ul |
| Price | |
| Order / More Info | APH1B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26717550 |