| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | APEX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The APEX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to APEX2. This antibody reacts with human. The APEX2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human APEX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLDYVLGDRTLVIDTFQASFLLPEVMGSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSPVLEQSTLQHNNQTRVQTCQNKAQVRSTRPQPSQVGSSRG |
|---|
| Other Names | AP endonuclease 2, APE2, APEX nuclease (apurinic/apyrimidinic endonuclease) 2, APEX nuclease 2, APEXL2, Apurinic-apyrimidinic endonuclease 2, DNA-(apurinic or apyrimidinic site) lyase 2, DNA-apurinic or apyrimidinic site lyase 2, EC 3.1, EC 4.2.99.18, XTH2 |
|---|
| Gene, Accession # | APEX2, Gene ID: 27301 |
|---|
| Catalog # | NBP2-58257 |
|---|
| Price | |
|---|
| Order / More Info | APEX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30686591 |
|---|
| 产品资料 |
|
|