| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | APEH |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The APEH Antibody from Novus Biologicals is a rabbit polyclonal antibody to APEH. This antibody reacts with human. The APEH Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human APEH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IARLKKPDQAIKGDQFVFYEDWGENMVSKSIPVLCVLDVESGNISVLEGVPENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRSA |
|---|
| Other Names | AARE, ACPH, acylamino-acid-releasing enzyme, acylaminoacyl-peptidase, Acyl-peptide hydrolase, APH, D3F15S2, D3S48EEC 3.4.19.1, DNF15S2, MGC2178, N-acylaminoacyl-peptide hydrolase, OPH, Oxidized protein hydrolase |
|---|
| Gene, Accession # | APEH, Gene ID: 327 |
|---|
| Catalog # | NBP1-85334 |
|---|
| Price | |
|---|
| Order / More Info | APEH Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|