| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Histatin 3 |
|---|
| Clone | 4G9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against recombinant protein with GST tag on ELISA. GST tag alone is used as a negative control. Use in Western blot reported in scientific literature (PMID: 28055279). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Histatin 3 Antibody (4G9) from Novus Biologicals is a mouse monoclonal antibody to Histatin 3. This antibody reacts with human. The Histatin 3 Antibody (4G9) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | HTN3 (AAH09791, 1 a.a. - 51 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN |
|---|
| Other Names | Basic histidine-rich protein, HIS2histatin 5, histatin 3, histatin-3, Histidine-rich protein 3, hst, HTN2, HTN5, PB |
|---|
| Gene, Accession # | HTN3, Gene ID: 3347, Accession: AAH09791, SwissProt: AAH09791 |
|---|
| Catalog # | H00003347-M01 |
|---|
| Price | |
|---|
| Order / More Info | Histatin 3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28055279 |
|---|
| 产品资料 |
|
|