| Edit |   |
| Antigenic Specificity | Histatin 1 |
| Clone | polyclonal |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified, no preservative |
| Size | 0.05 mg |
| Concentration | n/a |
| Applications | Western Blot. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Histatin 1 Antibody from Novus Biologicals is a mouse polyclonal antibody to Histatin 1. This antibody reacts with human. The Histatin 1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | HTN1 (NP_002150.1, 1 a.a. - 57 a.a.) full-length human protein. MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN |
| Other Names | HIS1Histidine-rich protein 1, histatin 1, histatin-1, Post-PB protein, PPB |
| Gene, Accession # | HTN1, Gene ID: 3346, Accession: NP_002150.1, SwissProt: NP_002150.1 |
| Catalog # | H00003346-B01P |
| Price | |
| Order / More Info | Histatin 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |