| Edit |   |
| Antigenic Specificity | Histamine N-Methyltransferase/HNMT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Histamine N-Methyltransferase/HNMT Antibody from Novus Biologicals is a rabbit polyclonal antibody to Histamine N-Methyltransferase/HNMT. This antibody reacts with human. The Histamine N-Methyltransferase/HNMT Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to HNMT (histamine N-methyltransferase) The peptide sequence was selected from the N terminal of HNMT. Peptide sequence PGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEP. |
| Other Names | EC 2.1.1.8, histamine N-methyltransferase, HMT, HNMT-S1, HNMT-S2 |
| Gene, Accession # | HNMT, Gene ID: 3176, Accession: P50135, SwissProt: P50135 |
| Catalog # | NBP1-69134 |
| Price | |
| Order / More Info | Histamine N-Methyltransferase/HNMT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |