| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Histamine H2R |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC-P reported in scientific literature (PMID: 26907350). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Histamine H2R Antibody from Novus Biologicals is a rabbit polyclonal antibody to Histamine H2R. This antibody reacts with human, mouse. The Histamine H2R Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Histamine H2 R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR |
|---|
| Other Names | gastric receptor 1, Gastric receptor I, H2R, HH2R, histamine H2 receptor, histamine receptor H2 |
|---|
| Gene, Accession # | HRH2, Gene ID: 3274 |
|---|
| Catalog # | NBP1-86082 |
|---|
| Price | |
|---|
| Order / More Info | Histamine H2R Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26907350 |
|---|
| 产品资料 |
|
|