| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SUCLG1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUCLG1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUCLG1. This antibody reacts with human, mouse, rat. The SUCLG1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat SUCLG1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPQNGIRHCSYTASRQHLYVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGA |
|---|
| Other Names | EC 6.2.1, EC 6.2.1.4, FLJ21114, FLJ43513, GALPHA, MTDPS9, SCS-alpha, succinate-CoA ligase, alpha subunit, succinate-CoA ligase, GDP-forming, alpha subunit, succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial, Succinyl-CoA synthetase subunit alpha, SUCLA1 |
|---|
| Gene, Accession # | SUCLG1, Gene ID: 8802 |
|---|
| Catalog # | NBP1-89489 |
|---|
| Price | |
|---|
| Order / More Info | SUCLG1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|