| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SUCLA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUCLA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUCLA2. This antibody reacts with human, mouse. The SUCLA2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse SUCLA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLP |
|---|
| Other Names | A-BETA, ATP-specific succinyl-CoA synthetase subunit beta, beta subunit, EC 6.2.1, EC 6.2.1.5, mitochondrial succinyl-CoA ligase [ADP-forming] subunit beta, MTDPS5, Renal carcinoma antigen NY-REN-39, succinate-CoA ligase, ADP-forming, beta subunit, succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial |
|---|
| Gene, Accession # | SUCLA2, Gene ID: 8803 |
|---|
| Catalog # | NBP1-85860 |
|---|
| Price | |
|---|
| Order / More Info | SUCLA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|