| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fucosyltransferase 2/FUT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fucosyltransferase 2/FUT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fucosyltransferase 2/FUT2. This antibody reacts with human. The Fucosyltransferase 2/FUT2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Fucosyltransferase 2/FUT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTL |
|---|
| Other Names | alpha (1,2) fucosyltransferase, Alpha(1,2)FT 2, alpha(1,2)FT2, B12QTL1, EC 2.4.1.69, Fucosyltransferase 2, fucosyltransferase 2 (secretor status included), galactoside 2-alpha-L-fucosyltransferase 2, GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2, Se, SE2, SEC2SE, Secretor blood group alpha-2-fucosyltransferase, Secretor factor, sej |
|---|
| Gene, Accession # | FUT2, Gene ID: 2524, Accession: Q10981, SwissProt: Q10981 |
|---|
| Catalog # | NBP1-80775 |
|---|
| Price | |
|---|
| Order / More Info | Fucosyltransferase 2/FUT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 30401457 |
|---|
| 产品资料 |
|
|