| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 35, Member C1 (SLC35C1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC35C1 is involved in GDP-fucose import from the cytoplasm into the Golgi lumen. |
|---|
| Immunogen | SLC35 C1 antibody was raised using the N terminal of SLC35 1 corresponding to a region with amino acids TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG |
|---|
| Other Names | GDP-Fuc-Tr|SLC35C1|wu:fc03b12|zgc:101867|CDG2C|FUCT1|E430007K15Rik|fuct1 |
|---|
| Gene, Accession # | Gene ID: 55343 |
|---|
| Catalog # | ABIN630296 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 35, Member C1 (SLC35C1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|