| 产品详情 |
| Edit |   |
| Antigenic Specificity | Cytochrome P450 3A5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cytochrome P450 3A5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytochrome P450 3A5. This antibody reacts with human. The Cytochrome P450 3A5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5) The peptide sequence was selected from the N terminal of CYP3A5. Peptide sequence AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL. |
| Other Names | aryl hydrocarbon hydroxylase, CP35, CYPIIIA5, cytochrome P-450, cytochrome P450 3A5, Cytochrome P450 HLp2, cytochrome P450, family 3, subfamily A, polypeptide 5, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 5, Cytochrome P450-PCN3, DKFZp686L16231, EC 1.14.14.1, flavoprotein-linked monooxygenase, microsomal monooxygenase, niphedipine oxidase, P450PCN3FLJ31317, PCN3, xenobiotic monooxygenase |
| Gene, Accession # | CYP3A5, Gene ID: 1577, Accession: P51589, SwissProt: P51589 |
| Catalog # | NBP1-68885 |
| Price | |
| Order / More Info | Cytochrome P450 3A5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|