| 产品详情 |
| Edit |   |
| Antigenic Specificity | AKT2 |
| Clone | X1 |
| Host Species | Mouse |
| Reactive Species | human, mouse, rat |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. This antibody is useful for ELISA, WB, IF and IHC-P. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AKT2 Antibody (X1) from Novus Biologicals is a mouse monoclonal antibody to AKT2. This antibody reacts with human, mouse, rat. The AKT2 Antibody (X1) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
| Immunogen | AKT2 (AAA58364, 100 a.a. - 189 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVII |
| Other Names | EC 2.7.11, EC 2.7.11.1, Murine thymoma viral (v-akt) homolog-2, PKB beta, PKBB, PKBBETA, PRKBB, Protein kinase Akt-2, Protein kinase B beta, rac protein kinase beta, RAC-BETA, RAC-beta serine/threonine-protein kinase, RAC-PK-beta, v-akt murine thymoma viral oncogene homolog 2 |
| Gene, Accession # | AKT2, Gene ID: 208, Accession: AAA58364, SwissProt: AAA58364 |
| Catalog # | H00000208-M06 |
| Price | |
| Order / More Info | AKT2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|