| 产品详情 |
| Edit |   |
| Antigenic Specificity | Prostaglandin E Synthase 2/PTGES2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Prostaglandin E Synthase 2/PTGES2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Prostaglandin E Synthase 2/PTGES2. This antibody reacts with human. The Prostaglandin E Synthase 2/PTGES2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Prostaglandin E Synthase 2/PTGES2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPILVAQEGESSQ |
| Other Names | C9orf15, chromosome 9 open reading frame 15, EC 5.3.99.3, FLJ14038, gamma-interferon-activated transcriptional element-binding factor 1, GATE-binding factor 1, GBF1, membrane-associated prostaglandin E synthase 2, Microsomal prostaglandin E synthase 2, microsomal prostaglandin E synthase-2, mPGES-2, PGES2MGC11289, prostaglandin E synthase 2 |
| Gene, Accession # | PTGES2, Gene ID: 80142 |
| Catalog # | NBP2-58108 |
| Price | |
| Order / More Info | Prostaglandin E Synthase 2/PTGES2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|