| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Prostaglandin E Synthase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC-P reported in scientific literature (PMID: 26801201). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Prostaglandin E Synthase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Prostaglandin E Synthase. This antibody reacts with human, mouse. The Prostaglandin E Synthase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse Prostaglandin E Synthase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAPRNDM |
|---|
| Other Names | EC 5.3.99.3, MGC10317, MGST1L1MGST1-like 1, MGST1-L1mPGES-1, MGST-IV, Microsomal glutathione S-transferase 1-like 1, Microsomal prostaglandin E synthase 1, MPGES, MPGES1, MPGES-1, p53-induced apoptosis protein 12, p53-induced gene 12 protein, PGESmicrosomal prostaglandin E synthase-1, PIG12glutathione S-transferase 1-like 1, PP102, PP1294, prostaglandin E synthase, TP53I12, tumor protein p53 inducible protein 12 |
|---|
| Gene, Accession # | PTGES, Gene ID: 9536 |
|---|
| Catalog # | NBP1-87852 |
|---|
| Price | |
|---|
| Order / More Info | Prostaglandin E Synthase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24133193, 24876670, 26801201, 27102561, 30538110 |
|---|
| 产品资料 |
|
|