| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALDH8A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALDH8A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALDH8A1. This antibody reacts with human. The ALDH8A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ALDH8A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVW |
|---|
| Other Names | Aldehyde dehydrogenase 12, aldehyde dehydrogenase 8 family, member A1, aldehyde dehydrogenase family protein, ALDH12aldehyde dehydrogenase family 8 member A1, DJ352A20.2, DKFZp779D2315, EC 1.2.1, EC 1.2.1.-, EC 1.2.1.3, MGC138650 |
|---|
| Gene, Accession # | ALDH8A1, Gene ID: 64577, Accession: Q9H2A2, SwissProt: Q9H2A2 |
|---|
| Catalog # | NBP2-38753 |
|---|
| Price | |
|---|
| Order / More Info | ALDH8A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|