| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALDH6A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALDH6A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALDH6A1. This antibody reacts with human, mouse, rat. The ALDH6A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat ALDH6A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHGQHEAVNFICDHPDIKAISFVGSNKAGEYIFERGSRHGKRVQ |
|---|
| Other Names | aldehyde dehydrogenase 6 family, member A1, Aldehyde dehydrogenase family 6 member A1, EC 1.2.1.18, EC 1.2.1.27, malonate-semialdehyde dehydrogenase, Malonate-semialdehyde dehydrogenase [acylating], methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial, MGC40271, MMSADHA, MMSDHmitochondrial acylating methylmalonate-semialdehyde dehydrogenase |
|---|
| Gene, Accession # | ALDH6A1, Gene ID: 4329 |
|---|
| Catalog # | NBP1-82636 |
|---|
| Price | |
|---|
| Order / More Info | ALDH6A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|