| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ALDH4A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ALDH4A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ALDH4A1. This antibody reacts with human. The ALDH4A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to ALDH4A1(aldehyde dehydrogenase 4 family, member A1) The peptide sequence was selected from the C terminal of ALDH4A1. Peptide sequence RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI. |
|---|
| Other Names | aldehyde dehydrogenase 4 family, member A1, Aldehyde dehydrogenase family 4 member A1, ALDH4DKFZp779M035, delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial, EC 1.5.1.12, mitochondrial delta-1-pyrroline 5-carboxylate dehydrogenase, P5C dehydrogenase, P5CD, P5CDh |
|---|
| Gene, Accession # | ALDH4A1, Gene ID: 8659, Accession: P30038, SwissProt: P30038 |
|---|
| Catalog # | NBP1-54740-20ul |
|---|
| Price | |
|---|
| Order / More Info | ALDH4A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|