| 产品详情 |
| Edit |   |
| Antigenic Specificity | ADAMTS3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ADAMTS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAMTS3. This antibody reacts with human. The ADAMTS3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ADAMTS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KPDGANLRQRSAQQAGSKTVRLVTVPSSPPTKRVHLSSASQMAAASFFAASDSIGASSQARTSKKDGKIID |
| Other Names | A disintegrin and metalloproteinase with thrombospondin motifs 3, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 3, ADAM metallopeptidase with thrombospondin type 1 motif, 3, ADAM-TS 3, ADAM-TS3, ADAMTS-3, ADAMTS-4, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.14, KIAA0366PC II-NP, Procollagen II amino propeptide-processing enzyme, Procollagen II N-proteinase, zinc metalloendopeptidase |
| Gene, Accession # | ADAMTS3, Gene ID: 9508, Accession: O15072, SwissProt: O15072 |
| Catalog # | NBP2-30775 |
| Price | |
| Order / More Info | ADAMTS3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|