| 产品详情 |
| Edit |   |
| Antigenic Specificity | ADAMTS2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ADAMTS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAMTS2. This antibody reacts with human. The ADAMTS2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ADAMTS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQPSNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLG |
| Other Names | A disintegrin and metalloproteinase with thrombospondin motifs 2, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 2, ADAM metallopeptidase with thrombospondin type 1 motif, 2, ADAM-TS 2, ADAMTS-2, ADAM-TS2EC 3.4.24.14, ADAMTS-3, EC 3.4.24, NPIDKFZp686F12218, PC I-NP, PCI-NP, PCINPhPCPNI, PCPNI, pNPI, Procollagen I N-proteinase, Procollagen I/II amino propeptide-processing enzyme, Procollagen N-endopeptidase |
| Gene, Accession # | ADAMTS2, Gene ID: 9509 |
| Catalog # | NBP1-89246 |
| Price | |
| Order / More Info | ADAMTS2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|