| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ACF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACF Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACF. This antibody reacts with human. The ACF Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAA |
|---|
| Other Names | ACF65, ACFASPACF64, apo-B RNA editing protein, APOBEC1 complementation factor, apobec-1 complementation factor (ACF) (ASP), APOBEC-1 stimulating protein, APOBEC1CF, APOBEC1-stimulating protein, MGC163391 |
|---|
| Gene, Accession # | A1CF, Gene ID: 29974 |
|---|
| Catalog # | NBP1-90271 |
|---|
| Price | |
|---|
| Order / More Info | ACF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|