| Edit |   |
| Antigenic Specificity | Acetyl-coenzyme A transporter 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Acetyl-coenzyme A transporter 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Acetyl-coenzyme A transporter 1. This antibody reacts with human. The Acetyl-coenzyme A transporter 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to SLC33A1(solute carrier family 33 (acetyl-CoA transporter), member 1) The peptide sequence was selected from the middle region of SLC33A1. Peptide sequence CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFF |
| Other Names | ACATNAcetyl-CoA transporter 1, acetyl-Coenzyme A transporter, AT-1acetyl-coenzyme A transporter 1, AT1SPG42, solute carrier family 33 (acetyl-CoA transporter), member 1, Solute carrier family 33 member 1, spastic paraplegia 42 (autosomal dominant) |
| Gene, Accession # | SLC33A1, Gene ID: 9197, Accession: O00400, SwissProt: O00400 |
| Catalog # | NBP1-59882 |
| Price | |
| Order / More Info | Acetyl-coenzyme A transporter 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |