| Edit |   |
| Antigenic Specificity | ACBD6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACBD6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACBD6. This antibody reacts with human. The ACBD6 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human ACBD6The immunogen for this antibody is ACBD6. Peptide sequence EAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVI. |
| Other Names | acyl-CoA binding domain containing 6, acyl-CoA-binding domain-containing protein 6, acyl-Coenzyme A binding domain containing 6, MGC2404 |
| Gene, Accession # | ACBD6, Gene ID: 84320, Accession: NP_115736, SwissProt: NP_115736 |
| Catalog # | NBP1-79817 |
| Price | |
| Order / More Info | ACBD6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |