| Edit |   |
| Antigenic Specificity | ACBD6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACBD6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACBD6. This antibody reacts with human. The ACBD6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ACBD6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHYASACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA |
| Other Names | acyl-CoA binding domain containing 6, acyl-CoA-binding domain-containing protein 6, acyl-Coenzyme A binding domain containing 6, MGC2404 |
| Gene, Accession # | ACBD6, Gene ID: 84320, Accession: Q9BR61, SwissProt: Q9BR61 |
| Catalog # | NBP1-81158 |
| Price | |
| Order / More Info | ACBD6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |