| Edit |   |
|---|
| Antigenic Specificity | Follistatin-related Gene Protein/FLRG/Fstl3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Follistatin-related Gene Protein/FLRG/Fstl3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Follistatin-related Gene Protein/FLRG/Fstl3. This antibody reacts with human. The Follistatin-related Gene Protein/FLRG/Fstl3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Follistatin-related Gene Protein/FLRG/Fstl3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAECCASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCKDSCDG |
|---|
| Other Names | FLRGFSRP, follistatin-like 3 (secreted glycoprotein), Follistatin-like protein 3, Follistatin-related gene protein, follistatin-related protein 3 |
|---|
| Gene, Accession # | FSTL3, Gene ID: 10272, Accession: O95633, SwissProt: O95633 |
|---|
| Catalog # | NBP2-32034 |
|---|
| Price | |
|---|
| Order / More Info | Follistatin-related Gene Protein/FLRG/Fstl3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|