| Edit |   |
|---|
| Antigenic Specificity | Follistatin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Follistatin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Follistatin. This antibody reacts with human. The Follistatin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FST(follistatin) The peptide sequence was selected from the middle region of FST. Peptide sequence ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN. |
|---|
| Other Names | follistatin, follistatin isoform FST317, FSActivin-binding protein |
|---|
| Gene, Accession # | FST, Gene ID: 10468, Accession: B5BU94, SwissProt: B5BU94 |
|---|
| Catalog # | NBP1-57997-20ul |
|---|
| Price | |
|---|
| Order / More Info | Follistatin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|