| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2. This antibody reacts with human. The ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNE |
|---|
| Other Names | alpha-2,8-sialyltransferase 8B, alpha-2,8-sialyltransferase 8B 1, EC 2.4.99, EC 2.4.99.-, HsT19690, MGC116854, MGC116857, sialyltransferase 8 (alpha-2, 8-sialytransferase) B, Sialyltransferase 8B, Sialyltransferase X, Sialytransferase St8Sia II, SIAT8B, SIAT8-B, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2, ST8SIA-II, STXST8SiaII |
|---|
| Gene, Accession # | ST8SIA2, Gene ID: 8128, Accession: Q92186, SwissProt: Q92186 |
|---|
| Catalog # | NBP2-33719 |
|---|
| Price | |
|---|
| Order / More Info | ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|