| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MTMR15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MTMR15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MTMR15. This antibody reacts with human. The MTMR15 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MTMR15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVVAVG |
|---|
| Other Names | DKFZp451H236, EC 3.1.21.-, EC 3.1.4.1, FANCD2/FANCI-associated nuclease 1DKFZp686K16147, fanconi anemia associated nuclease 1, fanconi-associated nuclease 1, KIAA1018coiled-coil domain-containing protein MTMR15, MTMR15, myotubularin related protein 15, Myotubularin-related protein 15 |
|---|
| Gene, Accession # | FAN1, Gene ID: 22909 |
|---|
| Catalog # | NBP2-56425 |
|---|
| Price | |
|---|
| Order / More Info | MTMR15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|