| Edit |   |
|---|
| Antigenic Specificity | ZBTB41 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZBTB41 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZBTB41. This antibody reacts with human. The ZBTB41 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZBTB41 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HLLEFLYTSEFFVYKYEIPLVLEAAKFLDIIDAVKLLNNENVAPFHSELTEKSSPEETLNELTGRLSNNHQCKFCS |
|---|
| Other Names | DKFZp686C06120, FLJ36199, FRBZ1, FRBZ1 protein (FRBZ1), zinc finger and BTB domain containing 41, zinc finger and BTB domain-containing protein 41 |
|---|
| Gene, Accession # | ZBTB41, Gene ID: 360023, Accession: Q5SVQ8, SwissProt: Q5SVQ8 |
|---|
| Catalog # | NBP2-38224 |
|---|
| Price | |
|---|
| Order / More Info | ZBTB41 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|