| 产品详情 |
| Edit |   |
| Antigenic Specificity | PPAP2B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PPAP2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPAP2B. This antibody reacts with human. The PPAP2B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PPAP2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSF |
| Other Names | Dri42, EC 3.1.3.4, lipid phosphate phosphohydrolase 3, LPP3PAP2 beta, MGC15306, PAP-2b, PAP2B, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, phosphatidic acid phosphatase type 2B, type-2 phosphatidic acid phosphatase-beta, vascular endothelial growth factor and type I collagen inducible, Vascular endothelial growth factor and type I collagen-inducible protein, VCIP |
| Gene, Accession # | PPAP2B, Gene ID: 8613 |
| Catalog # | NBP1-82825 |
| Price | |
| Order / More Info | PPAP2B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|