| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPAP2A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPAP2A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPAP2A. This antibody reacts with human, mouse. The PPAP2A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to PPAP2A(phosphatidic acid phosphatase type 2A) The peptide sequence was selected from the middle region of PPAP2A. Peptide sequence DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL. |
|---|
| Other Names | EC 3.1.3.4, lipid phosphate phosphohydrolase 1, lipid phosphate phosphohydrolase 1a, LLP1a, LPP1PAP2a2, PAP2, PAP2a, PAP2-alpha, PAP-2aPAP2alpha2, PAPalpha1, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, phosphatidic acid phosphatase type 2A, phosphatidic acid phosphohydrolase type 2a, type 2 phosphatidic acid phosphohydrolase, type-2 phosphatidic acid phosphatase alpha |
|---|
| Gene, Accession # | PPAP2A, Gene ID: 8611, Accession: O14494-2, SwissProt: O14494-2 |
|---|
| Catalog # | NBP1-59025 |
|---|
| Price | |
|---|
| Order / More Info | PPAP2A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|