| Edit |   |
| Antigenic Specificity | CYB5RL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CYB5RL Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYB5RL. This antibody reacts with human. The CYB5RL Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human LOC606495. Peptide sequence KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD. |
| Other Names | cytochrome b5 reductase-like |
| Gene, Accession # | CYB5RL, Gene ID: 606495, Accession: NP_001026842, SwissProt: NP_001026842 |
| Catalog # | NBP1-79619-20ul |
| Price | |
| Order / More Info | CYB5RL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |