| Edit |   |
| Antigenic Specificity | ZNF362 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF362 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF362. This antibody reacts with human. The ZNF362 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF362 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSPSGKGHSRMAEPRFNNPYFWPPPPTMPSQLDNLVLINKIKEQLMAEKIR |
| Other Names | HF.10, HF10Zinc finger protein HF.10, Zfp105, zinc finger protein 35, zinc finger protein 35 (clone HF.10) |
| Gene, Accession # | ZNF362, Gene ID: 149076, Accession: Q5T0B9, SwissProt: Q5T0B9 |
| Catalog # | NBP2-31756 |
| Price | |
| Order / More Info | ZNF362 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |