| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNF35 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF35 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF35. This antibody reacts with human. The ZNF35 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZNF35 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GAETKNLQLLVPKTEICEEAEKPLIISERIQKADPQGPELGEACEKGNMLKRQRIKREKKDFRQVIVNDCHLPESFKEEENQKCKKSGGKYSLNSGAVK |
|---|
| Other Names | BRF2, Butyrate response factor 2, ERF2ERF-2, Protein TIS11D, RNF162Czinc finger protein 36, C3H1 type-like 2, TIS11DEGF-response factor 2, zinc finger protein 36, C3H type-like 1, zinc finger protein 36, C3H type-like 2, zinc finger protein, C3H type, 36-like 2 |
|---|
| Gene, Accession # | ZNF35, Gene ID: 7584, Accession: P13682, SwissProt: P13682 |
|---|
| Catalog # | NBP2-30820 |
|---|
| Price | |
|---|
| Order / More Info | ZNF35 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|