| Edit |   |
| Antigenic Specificity | ZNF681 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF681 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF681. This antibody reacts with human. The ZNF681 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF681The immunogen for this antibody is ZNF681. Peptide sequence PWTRKRHRMVAEPPVICSHFAQDFSPEQNIKDSFQKVTPRRYGKCEHENL. |
| Other Names | zinc finger protein 681 |
| Gene, Accession # | ZNF681, Gene ID: 148213, Accession: NP_612143, SwissProt: NP_612143 |
| Catalog # | NBP1-79463 |
| Price | |
| Order / More Info | ZNF681 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |