| Edit |   |
| Antigenic Specificity | ZNF680 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF680 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF680. This antibody reacts with human. The ZNF680 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF680. Peptide sequence: QCLRTTQSKIFQCDKYVKVFHKFSNSNSHKKRNTGKKVFKCKECGKSFCM |
| Other Names | FLJ90430, zinc finger protein 680 |
| Gene, Accession # | ZNF680, Gene ID: 340252, Accession: EAW77967, SwissProt: EAW77967 |
| Catalog # | NBP1-79429 |
| Price | |
| Order / More Info | ZNF680 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |