| Edit |   |
|---|
| Antigenic Specificity | ZNF677 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF677 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF677. This antibody reacts with human. The ZNF677 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ZNF677 (zinc finger protein 677) The peptide sequence was selected from the N terminal of ZNF677. Peptide sequence YRNLLSLDEDNIPPEDDISVGFTSKGLSPKENNKEELYHLVILERKESHG. |
|---|
| Other Names | MGC48625, zinc finger protein 677 |
|---|
| Gene, Accession # | ZNF677, Gene ID: 342926, Accession: Q86XU0, SwissProt: Q86XU0 |
|---|
| Catalog # | NBP1-69213 |
|---|
| Price | |
|---|
| Order / More Info | ZNF677 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|