| Edit |   |
| Antigenic Specificity | ZNF674 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF674 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF674. This antibody reacts with human. The ZNF674 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF674. Peptide sequence GGTPVRTCAGEDRPEVWEVDEQIDHYKESQDKFLWQAAFIGKETLKDESG. |
| Other Names | MRX92, zinc finger protein 674 |
| Gene, Accession # | ZNF674, Gene ID: 641339, Accession: NP_001034980, SwissProt: NP_001034980 |
| Catalog # | NBP1-91371 |
| Price | |
| Order / More Info | ZNF674 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |