| Edit |   |
|---|
| Antigenic Specificity | ZNF121 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF121 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF121. This antibody reacts with human. The ZNF121 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF121The immunogen for this antibody is ZNF121. Peptide sequence LTKHVRIHTGEKPYECNECGKAYNRFYLLTEHFKTHTEEKPFECKVCGKS. |
|---|
| Other Names | D19S204, zinc finger protein 121, zinc finger protein 121 (clone ZHC32), Zinc finger protein 20, ZNF20ZHC32 |
|---|
| Gene, Accession # | ZNF121, Gene ID: 7675, Accession: NP_001008727, SwissProt: NP_001008727 |
|---|
| Catalog # | NBP1-79350 |
|---|
| Price | |
|---|
| Order / More Info | ZNF121 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|