| Edit |   |
| Antigenic Specificity | ZNF114 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF114 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF114. This antibody reacts with human. The ZNF114 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZNF114 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DSIRQCILTRDSSIFKYNPVLNDSQKTHENNEDDGVLGWNIQWVPCGRKTELKSSTWTGSQNTVHHIRDEIDTG |
| Other Names | MGC149700, MGC17986, zinc finger protein 114, zinc finger protein 114 (Y18) |
| Gene, Accession # | ZNF114, Gene ID: 163071 |
| Catalog # | NBP1-81180 |
| Price | |
| Order / More Info | ZNF114 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |