| Edit |   |
|---|
| Antigenic Specificity | ZNF100 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 50 ul |
|---|
| Concentration | lyophilized |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF100 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF100. This antibody reacts with human. The ZNF100 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF100. Peptide sequence MDDPRYGMCPLKGASGCPGAERSLLVQSYFEKGPLTFRDVAIEFSLEEWQ. |
|---|
| Other Names | FLJ44587, zinc finger protein 100, zinc finger protein 100 (Y1) |
|---|
| Gene, Accession # | ZNF100, Gene ID: 163227, Accession: NP_775802, SwissProt: NP_775802 |
|---|
| Catalog # | NBP1-80183 |
|---|
| Price | |
|---|
| Order / More Info | ZNF100 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|