| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRIM68 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRIM68 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRIM68. This antibody reacts with human. The TRIM68 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TRIM68 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLELNHSELIQQSQVLWRMIAELKERSQRPVRWMLQDIQEVLNRSKSWSLQQPEPISLELKTDCRVLG |
|---|
| Other Names | EC 6.3.2.-, FLJ10369, GC109MGC126176, RING finger protein 137RNF137, Ro/SSA1 related protein, SS56E3 ubiquitin-protein ligase TRIM68, SS-56SSA protein SS-56, tripartite motif containing 68, tripartite motif-containing 68, Tripartite motif-containing protein 68 |
|---|
| Gene, Accession # | TRIM68, Gene ID: 55128 |
|---|
| Catalog # | NBP1-83863 |
|---|
| Price | |
|---|
| Order / More Info | TRIM68 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|