| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | H4/h |
|---|
| Clone | 6D4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against recombinant protein on ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The H4/h Antibody (6D4) from Novus Biologicals is a mouse monoclonal antibody to H4/h. This antibody reacts with human. The H4/h Antibody (6D4) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | HIST1H4H (NP_003534, 31 a.a. - 103 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
|---|
| Other Names | H4 histone family, member H, H4/A, H4/B, H4/C, H4/D, H4/E, H4/h, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FHH4/G, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, HIST1H4E, HIST1H4F, HIST1H4I, HIST1H4J, HIST1H4K, HIST1H4L, HIST2H4, HIST2H4A, HIST2H4B, HIST4H4, histone 1, H4h, histone cluster 1, H4h, histone H4 |
|---|
| Gene, Accession # | HIST1H4H, Gene ID: 8365, Accession: NP_003534, SwissProt: NP_003534 |
|---|
| Catalog # | H00008365-M01 |
|---|
| Price | |
|---|
| Order / More Info | H4/h Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|