| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HGK/MAP4K4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HGK/MAP4K4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HGK/MAP4K4. This antibody reacts with human. The HGK/MAP4K4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to MAP4K4(mitogen-activated protein kinase kinase kinase kinase 4) The peptide sequence was selected from the N terminal of MAP4K4. Peptide sequence PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ. |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, FLH21957, FLJ10410, hepatocyte progenitor kinase-like/germinal center kinase-like kinase, HGKFLJ20373, HPK/GCK-like kinase HGK, KIAA0687, MAPK/ERK kinase kinase kinase 4, MEK kinase kinase 4, MEKKK 4, mitogen-activated protein kinase kinase kinase kinase 4, Nck-interacting kinase, NIKFLJ90111 |
|---|
| Gene, Accession # | MAP4K4, Gene ID: 9448 |
|---|
| Catalog # | NBP1-58853 |
|---|
| Price | |
|---|
| Order / More Info | HGK/MAP4K4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|