| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRMT61A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRMT61A Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRMT61A. This antibody reacts with human. The TRMT61A Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: TRMT61A |
|---|
| Immunogen | Synthetic peptides corresponding to C14ORF172 The peptide sequence was selected from the N terminal of C14ORF172. Peptide sequence MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI. |
|---|
| Other Names | C14orf172, chromosome 14 open reading frame 172, EC 2.1.1.36, FLJ40452, GCD14, Gcd14p, hTRM61, TRM61, tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRM61, tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRMT61A, tRNA methyltransferase 61 homolog A (S. cerevisiae), tRNA(m1A58)-methyltransferase subunit TRM61, tRNA(m1A58)-methyltransferase subunit TRMT61A, tRNA(m1A58)MTase subunit TRM61, tRNA(m1A58)MTase subunit TRMT61A |
|---|
| Gene, Accession # | TRMT61A, Gene ID: 115708, Accession: Q96FX7, SwissProt: Q96FX7 |
|---|
| Catalog # | NBP1-55087 |
|---|
| Price | |
|---|
| Order / More Info | TRMT61A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|