| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRMT12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRMT12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRMT12. This antibody reacts with human. The TRMT12 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TRMT12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVE |
|---|
| Other Names | Alpha-amino-alpha-carboxypropyl transferase TYW2, EC 2.1.1, EC 2.1.1.32, EC 2.5.1.-, FLJ20772, homolog of yeast tRNA methyltransferase, Trm12, tRNA methyltranferase 12 homolog, tRNA methyltranferase 12 homolog (S. cerevisiae), tRNA methyltransferase 12 homolog (S. cerevisiae), tRNA-yW synthesizing protein 2, tRNA-yW-synthesizing protein 2, TYW2tRNA wybutosine-synthesizing protein 2 homolog |
|---|
| Gene, Accession # | TRMT12, Gene ID: 55039 |
|---|
| Catalog # | NBP1-83633 |
|---|
| Price | |
|---|
| Order / More Info | TRMT12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|