| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRM11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRM11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRM11. This antibody reacts with human. The TRM11 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TRM11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FSVLEDYGLDPNCIPENPHNIYFGRWIADGQRELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGG |
|---|
| Other Names | C6orf75, chromosome 6 open reading frame 75, dJ187J11.2, EC 2.1.1, EC 2.1.1.-, EC 2.1.1.113, MDS024, TRM11, TRMT11-1, tRNA guanosine-2'-O-methyltransferase TRM11 homolog, tRNA methyltransferase 11 homolog (S. cerevisiae) |
|---|
| Gene, Accession # | TRMT11, Gene ID: 60487 |
|---|
| Catalog # | NBP2-57607 |
|---|
| Price | |
|---|
| Order / More Info | TRM11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|